DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:235 Identity:72/235 - (30%)
Similarity:108/235 - (45%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSN--- 95
            |||:.|..::|..||..||:|..|...||||:..::..::||..|....  .::|:..||::   
Mosquito    49 GRIINGFASDIANYPFAISVRRDGQFYCGGTVISASYALTAATPVYPYR--NSITLYGGSTSANS 111

  Fly    96 --IWFPTGPQQELEVREIIIH----PKYRTLNNDYDAAILILDGD-FEFNDAVQPIELAKERPDH 153
              :.|        :|..|.:|    |..|.  :||:.|||.:..: |.....:.||.||......
Mosquito   112 GGVLF--------KVLMIAVHLLFNPNDRV--SDYNIAILTVPANAFGGRRNIAPIPLASAEVAI 166

  Fly   154 DTPVTVTGWGTTSEG--GTISDVLQEVSVNVVDNSNCKNAY---SIMLTSRMLCA-GVNGGGKDA 212
            .|..||.|||.|:..  |. ::.|:...:.:...:.|..|:   |:.|||.|:|| ||.|.  |.
Mosquito   167 GTKCTVFGWGRTNANLPGP-ANALRSADMVISSGATCARAWGPLSVQLTSNMICAKGVRGA--DL 228

  Fly   213 CQGDSGGPLVYNNTLLGIVSWGT-GCAREKYPGVYCSVPD 251
            |.||.|..||....|.||....: ||...: ..||..:.:
Mosquito   229 CIGDYGNALVCRGKLNGIAFLASPGCDNTR-DSVYMRITE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/234 (30%)
Tryp_SPc 36..259 CDD:238113 70/233 (30%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 71/234 (30%)
Tryp_SPc 51..268 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.