DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP010615

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001237581.1 Gene:AgaP_AGAP010615 / 4577718 VectorBaseID:AGAP010615 Length:272 Species:Anopheles gambiae


Alignment Length:264 Identity:81/264 - (30%)
Similarity:120/264 - (45%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVL-GVGCS---LADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIY 66
            |:.||| |:.|.   |.|...:|:.....: .||||.|:..:|.:|.:.:|:|..|...||.||.
Mosquito     4 VISLVLFGLFCGSAVLTDASDQNKPDGASQ-SGRIVNGKAVSIVKYKYALSLRVNGVFECGATII 67

  Fly    67 RSNQIISAAHCVNTLS-GPENLTIVAGSSNIWFPTGPQQELEVREIIIHP----KYRTLNNDYDA 126
            .....::|||||.... .|..:::..||::.  .||......|| |.:||    .|....::||.
Mosquito    68 THKHALTAAHCVYPQRFEPMRVSLYGGSTSA--VTGGVLFSVVR-IAVHPGYDHSYFPDASEYDV 129

  Fly   127 AIL-ILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTIS-DVLQEVSVNVVDNSNCK 189
            |:| :.:..|.....:..:.|........|...|.|||.|......| :.|:...:.:||.|.|.
Mosquito   130 AVLTVANNAFSGKPNMASLILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLRYAEMTIVDQSTCA 194

  Fly   190 NAYSI----MLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVS---------WGTGCAREK 241
            .|::.    .:||.|:||.. |.|.|.|:|||||.||....|.|:||         |..|.::..
Mosquito   195 RAWATYPRQRVTSNMICAKY-GNGVDTCKGDSGGALVCGGGLAGVVSFTNLECTSAWPAGFSKIS 258

  Fly   242 YPGV 245
            .|.:
Mosquito   259 APSI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/231 (31%)
Tryp_SPc 36..259 CDD:238113 70/230 (30%)
AgaP_AGAP010615XP_001237581.1 Tryp_SPc 36..259 CDD:214473 70/226 (31%)
Tryp_SPc 37..258 CDD:238113 69/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.