DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP012036

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_552175.3 Gene:AgaP_AGAP012036 / 4577673 VectorBaseID:AGAP012036 Length:370 Species:Anopheles gambiae


Alignment Length:247 Identity:62/247 - (25%)
Similarity:103/247 - (41%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWF-------------PTGPQ-------Q 104
            ||.||:.:...:::|||||:.|       ||:.|....|             .|..|       |
Mosquito   138 RCVGTLIQERYVLTAAHCVHNL-------IVSFSLQCLFLRRIKLYFGLFLISTLGQCLADRVCQ 195

  Fly   105 ELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI----------ELAKERPDHDTPVTV 159
            |....|:|:|..|.:.....|.|::.:....:|...|:|.          .||..|      |..
Mosquito   196 ERRAAELIVHQDYNSHARLNDIALIRVSEAVQFTQDVRPACLPFNYLFDESLASPR------VLS 254

  Fly   160 TGWGTTSEGGTISDVLQEVSVNVVDNSNCKN------AYSIMLTSRMLCAGVNGGGKDACQGDSG 218
            .|||...: ||:||..:.|.:.::....|.:      .::|.:.|.::|......|:|.|:||||
Mosquito   255 LGWGEYQQ-GTMSDSKRIVQLEIIKEDECGDQLKKWQRFNISMISSVMCTVGVLAGQDVCEGDSG 318

  Fly   219 GPLVYNNT----LLGIVSW------GTGCAREKYPGVYCSVPDVLDWLVETV 260
            .|:|....    ::|:||:      |||.|     |:...|.:..:|::.::
Mosquito   319 APIVQIRNDRYFVIGVVSFGPKCGMGTGTA-----GMSTRVSEYKNWILTSM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 61/240 (25%)
Tryp_SPc 36..259 CDD:238113 62/244 (25%)
AgaP_AGAP012036XP_552175.3 CLIP 28..83 CDD:288855
Tryp_SPc 122..361 CDD:214473 61/241 (25%)
Tryp_SPc 122..361 CDD:238113 61/241 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.