DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP011040

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001237041.2 Gene:AgaP_AGAP011040 / 4577547 VectorBaseID:AGAP011040 Length:284 Species:Anopheles gambiae


Alignment Length:248 Identity:74/248 - (29%)
Similarity:108/248 - (43%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ISMRYRGNHR---------------CGGTIYRSNQIISAAHCV---NTLSGPENLTIVAGSSNIW 97
            ||||....|.               |||::...:.:::||||:   |||..|  |.:..|..|:.
Mosquito    24 ISMRLEHTHAAAIGWLNEKGKIEFGCGGSLILESFVLTAAHCMDNPNTLERP--LVVRLGDRNLI 86

  Fly    98 FPTGPQ--QELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVT 160
            .....:  ||:::|:||.||||....:.:|.|:|:||........|.|..|..|.....:.:...
Mosquito    87 HSKDSEYAQEIKIRDIIPHPKYNRATSHFDIALLVLDKPARRVFGVIPACLWLEDELLFSTLYAA 151

  Fly   161 GWGTTSEGGTISDVLQEVSVNVVDNSNC----KNAYSIM-----LTSRMLCAGVNGGGKDACQGD 216
            |||........::.|....:..|.|..|    |.....|     ::...|||.  |...|.|:||
Mosquito   152 GWGANGFDKKPTNYLVTAVLQPVTNEECIDKLKRQVPRMKLANGISDHQLCAA--GIEMDTCKGD 214

  Fly   217 SGGPLVYNNT---------LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ||||| |:..         |:|:.|:|..|...: ||||..|....||::||:
Mosquito   215 SGGPL-YSKLNFANKLVPFLVGLTSYGGPCGFSQ-PGVYVRVSKFRDWIIETI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 70/241 (29%)
Tryp_SPc 36..259 CDD:238113 72/245 (29%)
AgaP_AGAP011040XP_001237041.2 Tryp_SPc 49..264 CDD:238113 67/220 (30%)
Tryp_SPc 49..261 CDD:214473 66/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.