DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP006675

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001237857.2 Gene:AgaP_AGAP006675 / 4576700 VectorBaseID:AGAP006675 Length:302 Species:Anopheles gambiae


Alignment Length:244 Identity:84/244 - (34%)
Similarity:122/244 - (50%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYR---GNHRCGGTIYRSNQIISAAHCVNTLSGPENL----TIVAG 92
            |||.||:....|:|:||::...   |...|||||..:..|::|||||  :.|...|    |.:.|
Mosquito    55 RIVNGQEAVPGQFPYQIALLSNFAAGGGLCGGTIITNTFILTAAHCV--VDGAGALATDGTAILG 117

  Fly    93 SSNIWFPTGPQQELE-VRE-IIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDT 155
            :.|.......||.:. ||: :.:||.|.......|.|.:.|:....||:.|||||| ..|.|..|
Mosquito   118 AHNRTATEPTQQRIGFVRDGVFVHPSYSATLIRNDIATVRLNSPAVFNERVQPIEL-PARSDSRT 181

  Fly   156 PV----TVTGWGTTSEG--GTISDVLQEVSVNVVDNSNCKNAYSIMLTS-RMLCAGVNGGGKDAC 213
            ..    |.:|:|.||:.  |. |||:...|..|:.|:.|.:|::|:|.| :.:|.... ||:..|
Mosquito   182 FAGMIGTASGFGRTSDALPGA-SDVVMYTSNPVMTNAACVSAWNIILVSDQNVCLDAT-GGRSVC 244

  Fly   214 QGDSGGPLVY----NNTLLGIVSW--GTGCAREKYPGVYCSVPDVLDWL 256
            .|||||||..    .:..:||.|:  ..||| ...|.|:..:....|::
Mosquito   245 NGDSGGPLTVQDGGESLEIGIASFVSAQGCA-SGIPSVWVRISFYRDFI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 83/241 (34%)
Tryp_SPc 36..259 CDD:238113 83/243 (34%)
AgaP_AGAP006675XP_001237857.2 Tryp_SPc 55..292 CDD:214473 84/242 (35%)
Tryp_SPc 56..295 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.