DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and prss36

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:266 Identity:90/266 - (33%)
Similarity:130/266 - (48%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.:..|||||.|.....:|.|:|:||||:|.|||::..:..|::||||......|.:..:..|:.
 Frog    31 PLVSSRIVGGTDAREGAWPWQVSLRYRGSHICGGSVIGTQWILTAAHCFGNSQSPSDYEVRLGAY 95

  Fly    95 NIWFPTGPQQ-ELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT 158
            .: ..|.|.: ..:|..||:||:|..|....|.|::.|....::...:.|:.|    |......|
 Frog    96 RL-AETSPNEITAKVDRIIMHPQYDELTYFGDIALIRLTSPIDYTAYILPVCL----PSASNSFT 155

  Fly   159 ------VTGWGTTSEG------GTISDVLQEVSVNVVDNSNCKNAYSI---------MLTSRMLC 202
                  |||||.|:..      ||    ||||...:::.:.|...|.|         ::.|..:|
 Frog   156 DGMECWVTGWGKTAFNVNLPFPGT----LQEVMTPLINRTRCDQMYHIDSPVSASSEIIPSDQIC 216

  Fly   203 AGVNGGGKDACQGDSGGPLV-------YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            :|.:.||||:|:|||||.||       |.   :||||||.|||....||||..||....||....
 Frog   217 SGYSDGGKDSCKGDSGGALVCKIQRVWYQ---IGIVSWGDGCAIANRPGVYTLVPAYQSWLSSYN 278

  Fly   261 ADKESV 266
            |.:.::
 Frog   279 ATENTI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/248 (35%)
Tryp_SPc 36..259 CDD:238113 87/251 (35%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113 87/250 (35%)
Tryp_SPc 385..622 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.