DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CTRB2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:277 Identity:87/277 - (31%)
Similarity:135/277 - (48%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGV--GCSLADPIYRNEEVHIPKLDG--RIVGGQDTNITQYPHQISMRYR-GNHRCGG 63
            :|..:.:||.  ||.:       ..:| |.|.|  |||.|:|.....:|.|:|::.: |.|.|||
Human     6 LLSCWALLGTTFGCGV-------PAIH-PVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGG 62

  Fly    64 TIYRSNQIISAAHC-VNTLSGPENLTIVAGSSNIWFPTGPQQE----LEVREIIIHPKYRTLNND 123
            ::...:.:::|||| |.|..     .:|||.    |..|..:|    |::.::..:||:..|..:
Human    63 SLISEDWVVTAAHCGVRTSD-----VVVAGE----FDQGSDEENIQVLKIAKVFKNPKFSILTVN 118

  Fly   124 YDAAILILDGDFEFNDAVQPIELAKERPDHDTPV----TVTGWGTTS-EGGTISDVLQEVSVNVV 183
            .|..:|.|.....|:..|..:.|..  .|.|.|.    ..||||.|. ......|.||:.::.::
Human   119 NDITLLKLATPARFSQTVSAVCLPS--ADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLL 181

  Fly   184 DNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPG 244
            .|:.||.::...:|..|:|||.:  |..:|.||||||||...    ||:||||||:.......|.
Human   182 SNAECKKSWGRRITDVMICAGAS--GVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSRTCSTTTPA 244

  Fly   245 VYCSVPDVLDWLVETVA 261
            ||..|..::.|:.:.:|
Human   245 VYARVAKLIPWVQKILA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 76/234 (32%)
Tryp_SPc 36..259 CDD:238113 76/237 (32%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 76/235 (32%)
Tryp_SPc 34..259 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.