DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP012842

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001230353.1 Gene:AgaP_AGAP012842 / 4397614 VectorBaseID:AGAP012842 Length:110 Species:Anopheles gambiae


Alignment Length:104 Identity:45/104 - (43%)
Similarity:58/104 - (55%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIM---LTSRMLCAGVNGGGKDACQGDSGGP 220
            |:|||.|......:|||:..:|..|:...|..||..|   :|.:|.|||...||:|.|:.|||||
Mosquito     4 VSGWGLTLSDADSNDVLRATNVPTVNQQECNKAYQSMYGGITDQMFCAGYKQGGQDTCRQDSGGP 68

  Fly   221 LVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVET 259
            .|....|:|::|||..||...|||||..|....||:..|
Mosquito    69 FVAEGKLIGVISWGHECALAGYPGVYARVASARDWIRAT 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 42/98 (43%)
Tryp_SPc 36..259 CDD:238113 44/102 (43%)
AgaP_AGAP012842XP_001230353.1 Tryp_SPc <1..107 CDD:238113 44/102 (43%)
Tryp_SPc <1..104 CDD:214473 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.