DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG34130

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:219 Identity:46/219 - (21%)
Similarity:92/219 - (42%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGGTIYRSNQIISAAHCVNT-LSGPENLTIVAGSSNIWFPTGPQQELE--------VREIIIHPK 116
            ||.:...:...:::|:|::: .|..|:|::...||:    :....:|:        :|.||:...
  Fly    69 CGASYLSALYALTSANCMHSHRSQMESLSVELVSSD----SRQDNQLDSHDPPNALIRNIIVSKD 129

  Fly   117 YRTLNNDYDAAILILDGDFEFND------AVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVL 175
            :.......|.|::.|......|.      ...|:...|.       ::|..:|    .|...:|.
  Fly   130 WHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSYKS-------LSVVSYG----AGPAENVR 183

  Fly   176 QEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAR 239
            .| .:.|::...|.:|| :.:|...:.||.......| |...:|.|:...:.|.|||:|...|.|
  Fly   184 TE-EIEVLNRMICDSAYGNFLLRETVACAKEFKRSAD-CMFSAGCPVTAGDQLCGIVAWSPACKR 246

  Fly   240 EKYPGVYCSVPDVLDWLVETVADK 263
            ...||::..:..|..::::.::.|
  Fly   247 SNLPGIFTDIHQVKRFILKAISGK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 45/209 (22%)
Tryp_SPc 36..259 CDD:238113 45/213 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 45/210 (21%)
Tryp_SPc 53..256 CDD:304450 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.