DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG11843

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:289 Identity:77/289 - (26%)
Similarity:116/289 - (40%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISM------RYRGNHRC 61
            ||...||:  .|.|:...|..|...:.|    .||||......::||...:      ..|.:..|
  Fly    41 RIEFGFLL--PGASIESRIIDNCRSYTP----LIVGGHPAQPREFPHMARLGRRPDPSSRADWFC 99

  Fly    62 GGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPT----GPQQELEVREIIIHPKYRTLNN 122
            ||.:.....:::||||:.:..|..|   |.....:.|.:    ...::..|...|.||.|.....
  Fly   100 GGVLISERFVLTAAHCLESERGEVN---VVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQF 161

  Fly   123 DYDAAILILDGDFEFNDAVQPIELA-KERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNS 186
            .:|..::.|.....|:....|..|. ::....|:.:.| |||:|......|..|.:|.:....|.
  Fly   162 YHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAV-GWGSTGLALKPSAQLLKVKLQRYGNW 225

  Fly   187 NCKNAYSIMLT------------SRMLCAGVNGGGKDACQGDSGGP-LVYNN------TLLGIVS 232
            .||.    :||            :..||.| :...:|.|.|||||| |:|:.      .::||.|
  Fly   226 VCKK----LLTRQVEEFPRGFDGNNQLCVG-SEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITS 285

  Fly   233 WGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            .|..|.....||:|..|...|.|:..|:|
  Fly   286 AGLSCGSPGIPGIYTRVYPYLGWIARTLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 65/249 (26%)
Tryp_SPc 36..259 CDD:238113 66/252 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 66/252 (26%)
Tryp_SPc 68..309 CDD:214473 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.