DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and intr

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:95/242 - (39%) Gaps:54/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EVHIPKLDGRIVGGQDTNITQYPHQIS---MR--YRGNHRCGGTIYRSNQIISAAHCV-NTL--S 82
            |:...:::..:..||.|  |:.|..:.   ||  |.....|.|.:..:..::::|.|. .||  .
  Fly    75 EIIPAEIETLLTDGQAT--TEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQP 137

  Fly    83 GPENLTIVAGSSNIW----FPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQP 143
            .|.:..:.|..|.|:    ..||..:                    |.|:|:|....| :..|.|
  Fly   138 PPRSYKLQASRSRIYSVANLITGAIE--------------------DMALLLLHAPLE-DPFVHP 181

  Fly   144 IELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY----SIMLTSRMLCAG 204
            |:|.:.....:..||:.         .....|:.:...::.|||||.:|    :..:|..|||| 
  Fly   182 IDLCESPLRRNDNVTMY---------MSQQHLRFLRTKLIPNSNCKRSYAQDENAFITQTMLCA- 236

  Fly   205 VNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCA-----REKYPGVY 246
            :|......||...|..|::.:.|.|:..:|..|:     .|.|..|:
  Fly   237 LNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 55/233 (24%)
Tryp_SPc 36..259 CDD:238113 55/232 (24%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 47/203 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.