DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG4815

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:252 Identity:58/252 - (23%)
Similarity:92/252 - (36%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR-CGGTIYRSNQIISAAHCVNTLSGPENL 87
            |.|....:...||..|..|.:..........:.|... |..|:.....|::||||...|: ....
  Fly    23 NREEWTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLN-RSKF 86

  Fly    88 TIVAGSSN--IWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI------ 144
            .::.|.|.  .|......:...:| :.|||||..:....|.|:.         ....|:      
  Fly    87 HVIGGKSAEFTWHGNNFNKNKLIR-VQIHPKYAKMKFIADVAVA---------KTKYPLRSKYIG 141

  Fly   145 --ELAKERPDHDTPVTVTGWGTTSEGGTISD----VLQEVSVNVVDNSNCKNAYSIMLTSRMLCA 203
              :|.:........:...|||  .|||...:    ..:.:.|.:|...:|:......:...::||
  Fly   142 YAQLCRSVLHPRDKLIAAGWG--FEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICA 204

  Fly   204 GVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            |.. ..|..|.|||||||:....:.||.:|...|...:.|.||..|.....::..|:
  Fly   205 GAY-NNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 55/234 (24%)
Tryp_SPc 36..259 CDD:238113 54/237 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 51/223 (23%)
Trypsin 49..256 CDD:278516 51/220 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.