DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and grass

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:123/262 - (46%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMRYR--GNHR--CGGTIYRSNQIISAAHCVNTLSGPENLTIVAG 92
            |..|:..|.:..::..|....:||:  |..|  |||.:.....|::|||||:.|.. :...|..|
  Fly   115 LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN-DLYEIRLG 178

  Fly    93 SSNIWFPTGPQQE------------LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIE 145
            ...|......:|:            :.:.:.:||.||...:..:|.|:|.|:....|...::||.
  Fly   179 EHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPIC 243

  Fly   146 L-----AKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGV 205
            |     .||:.:..:...||||||| |.|:.||||.:.:|.:...|.|..||...:....||.| 
  Fly   244 LPITDELKEKAEQISTYFVTGWGTT-ENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQLCVG- 306

  Fly   206 NGGGKDACQGDSGGPLVYNNTLL----------GIVSWG-TGCAREKYPGVYCSVPDVLDWLVET 259
            .|..:|:|:|||||||......|          ||||.| ..|.:...||:|.:|.:.:.|:.:|
  Fly   307 GGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITDT 371

  Fly   260 VA 261
            :|
  Fly   372 MA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/251 (31%)
Tryp_SPc 36..259 CDD:238113 77/254 (30%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.