DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Tmprss9

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:248 Identity:92/248 - (37%)
Similarity:130/248 - (52%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLD--GRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAG 92
            |.:|  .|||||......:.|.|.|::....|.||.|:.....::|||||.|. :..|.:....|
Mouse   749 PAMDKPTRIVGGISAVSGEVPWQASLKEGPRHFCGATVVGDRWLLSAAHCFNH-TKVEQVQAHLG 812

  Fly    93 SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV 157
            :.::....|...:|.:|.:.:||:|.....|:|.|:|.|.....||..:||:.|  ....|..||
Mouse   813 TVSLLGVGGSPVKLGLRRVALHPRYNPGILDFDVALLELAQPLVFNKYIQPVCL--PLAIHKFPV 875

  Fly   158 ----TVTGWGTTSEG-GTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDS 217
                .::|||...|| .|..|:||:.||.:::...|...|:..||.||||||...|..|:|||||
Mouse   876 GRKCMISGWGNMQEGNATKPDILQKASVGIIEQKMCGALYNFSLTDRMLCAGFLEGRVDSCQGDS 940

  Fly   218 GGPLVYNNT-----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
            ||||....|     |.||||||.|||:.|.||||..:..:.||:::.::...|
Mouse   941 GGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITRLKDWILKAMSSDPS 993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/229 (38%)
Tryp_SPc 36..259 CDD:238113 88/232 (38%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473 88/230 (38%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.