DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG15498

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:152 Identity:31/152 - (20%)
Similarity:48/152 - (31%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIH----PKY 117
            |.:...|..:|...:..|...:...|||:.|.:.......:|.|...:......::.|    |..
  Fly   134 GQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSA 198

  Fly   118 RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQ------ 176
            |...:.........|.|..|...      .|..|.|:..|.|  ...|:....:.:||.      
  Fly   199 RVPTSHTHFFCAHKDPDLRFESE------GKTIPVHNPLVIV--HAVTNRNLAVENVLANTLFGP 255

  Fly   177 --EVSV----NVVDNSNCKNAY 192
              :|||    ||......||.:
  Fly   256 EFQVSVQTYKNVYKRETWKNLW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 31/152 (20%)
Tryp_SPc 36..259 CDD:238113 31/152 (20%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.