DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG5255

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:125/269 - (46%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGN--HRCGGTIYR 67
            ||:|........|..|.|..         .|||||::......|:|||::..|:  |.|||.|..
  Fly     8 LVLFTSSAASQILYPPQYTK---------NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63

  Fly    68 SNQIISAAHCV--------NTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDY 124
            ...||:||||.        ..|:|.::|.  ...|..::|.         .|:.|..|.......
  Fly    64 ERWIITAAHCTRGRQATAFRVLTGTQDLH--QNGSKYYYPD---------RIVEHSNYAPRKYRN 117

  Fly   125 DAAILILDGDFEFNDAVQPIELAKERPDHDTPV-----TVTGWGTTSEGGTISDVLQEVSVNVVD 184
            |.|:|.|:....|::|.||:||     ||:..|     .:|||||.|.||.:...||.:.||.|.
  Fly   118 DIALLHLNESIVFDNATQPVEL-----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVP 177

  Fly   185 NSNCKNAY--SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYC 247
            ...|:.|:  |..:....:|. .|..|:.||.||||||||:|..|:.:|:||..||: .||..:.
  Fly   178 FEQCRAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHA 240

  Fly   248 SVPDVLDWL 256
            |:....|::
  Fly   241 SISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/236 (34%)
Tryp_SPc 36..259 CDD:238113 81/238 (34%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 82/237 (35%)
Tryp_SPc 30..252 CDD:238113 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.