DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG14892

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:364 Identity:83/364 - (22%)
Similarity:124/364 - (34%) Gaps:140/364 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMR-------YRGNHRCGGTIYRSNQIISAAHCVN----TLSGPENLT 88
            ||:.|..||..|:|.|.|:.       :.| |.||..:.....|:||||||:    .|..|...|
  Fly    80 RIIAGAATNEGQFPWQASLELLHPSLGFLG-HWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWT 143

  Fly    89 IVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDY----------------------------- 124
            :|.|..:....:|.:|.:.|.:|::|.:|....:|.                             
  Fly   144 VVLGEHDRDVESGNEQRIPVEKIVMHHRYHNFKHDVVLMKLSKPADLTRASNIRRICLPFLLAES 208

  Fly   125 ---------------DAAILILDGDFEFNDAVQPIE----------------------------- 145
                           |..:||  ...|..|..:.|:                             
  Fly   209 PDQAQSETVSPPSSADEDVLI--QQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKIL 271

  Fly   146 ------LAKERP-DH-------------------------------DTPVTV-------TGWGTT 165
                  ||:..| .|                               |.|..:       ||||..
  Fly   272 SRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKA 336

  Fly   166 SEGGTISDVLQEVSVNVVDNSNCKNAYS--IMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNT-- 226
            :..|.:|:.|.:..|.:..|..|::||.  :.:....||||...|....|.|||||||....:  
  Fly   337 NISGDLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRD 401

  Fly   227 ----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
                |:|:.|:|:|||.|.:|.||......:.|:.:|:|
  Fly   402 GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIEDTIA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 80/356 (22%)
Tryp_SPc 36..259 CDD:238113 80/359 (22%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 80/357 (22%)
Tryp_SPc 81..438 CDD:238113 80/359 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.