DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG3505

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:291 Identity:80/291 - (27%)
Similarity:126/291 - (43%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVGCSLADPIYRNEEVHIPKLDGRI----VGGQDTNITQYPHQISMRY-RGN----HRCGGTIYR 67
            |:| :|..|:       :|...|::    ....||.|.::|....:.| |||    |.|||.:..
  Fly    87 GLG-ALTHPL-------LPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLIS 143

  Fly    68 SNQIISAAHCVNTLSGPENLTIVAGSSNIWFPT-----------------GPQQELEVREIIIHP 115
            ...:::||||| ..:...||.|.|.....|..:                 .|.|::.:.|::.||
  Fly   144 DRYVLTAAHCV-AQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHP 207

  Fly   116 KY----RTLNNDYDAAILILDGDFEFNDAVQPIELAKE--RPD--HDTPVTVTGWGTTSEGGTIS 172
            .|    ||..|  |.|::.|....:.||.||||.|..:  |.|  .|....|.||..:|     |
  Fly   208 LYNRTDRTQIN--DIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASS-----S 265

  Fly   173 DVLQEVSVNVVDNSNCKNAYS---IMLTSRMLCAGVNGGGKDACQGDSGGPL-VYNN---TLLGI 230
            ..:::..|.:.....|:..|:   :.:.:..||...|   ...|.|::|||| ::.|   .|.|:
  Fly   266 QRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTN---SQECYGNAGGPLMLFKNDGYLLGGL 327

  Fly   231 VSWG-TGCAREKYPGVYCSVPDVLDWLVETV 260
            ||:| ..|....:|.||..|...:||:.:::
  Fly   328 VSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 72/261 (28%)
Tryp_SPc 36..259 CDD:238113 74/264 (28%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 74/255 (29%)
Tryp_SPc 111..354 CDD:214473 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.