DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and snk

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:255 Identity:84/255 - (32%)
Similarity:130/255 - (50%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRY-RGNHR--------CGGTIYRSNQIISAAHCVNTLSGPENLTIVA 91
            ||||..|....:||..::.: :|:..        |||.:.....:::||||..:.|.|.:: :..
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDM-VRL 249

  Fly    92 GSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
            |:..:...:..||::::..|::|||||:....:|.|:|.|....:|::.|:|..| .:.|:...|
  Fly   250 GARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL-WQLPELQIP 313

  Fly   157 -VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRML---------CAGVNGGGKD 211
             |...|||.|...|..|:.|::|.::||....||..|.   ..|.|         |||...||:|
  Fly   314 TVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYR---KERRLPRGIIEGQFCAGYLPGGRD 375

  Fly   212 ACQGDSGGPL-----VYNNT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
            .||||||||:     .||..  ::||.|:|..||....||||..:...||| :|.:|.|:
  Fly   376 TCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDW-IEKIAFKQ 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 79/244 (32%)
Tryp_SPc 36..259 CDD:238113 81/248 (33%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 82/249 (33%)
Tryp_SPc 186..427 CDD:214473 81/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.