DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG16749

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:234 Identity:91/234 - (38%)
Similarity:127/234 - (54%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQISMR-YRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            ||:|.|.|:::.:||..|||| ..|:|.|||:|.....:::||||.:.... .:|::..|.:.| 
  Fly    28 GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKA-SDLSVQYGVTKI- 90

  Fly    98 FPTGPQQELEVREIIIHPKYRTLNNDY--DAAILILDGDFEFND-AVQPI---ELAKERPDHDT- 155
            ..||| ..:.|::||.|..|...|| |  |.::|:::..|||:. .|.|:   |||...|..|. 
  Fly    91 NATGP-NVVRVKKIIQHEDYNPYNN-YANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAG 153

  Fly   156 -PVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRM-LCAGVNGGGKDACQGDSG 218
             ...:.|||..:.||.|...||||.:.|..:..|...:......|. :|.||:.|||..|.||||
  Fly   154 GEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSG 218

  Fly   219 GPLVYNNTLLGIVSWG-TGCAREKYPGVYCSVPDVLDWL 256
            |||:||...:|||||. ..|....||||||.|...:||:
  Fly   219 GPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 88/230 (38%)
Tryp_SPc 36..259 CDD:238113 89/232 (38%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 89/231 (39%)
Tryp_SPc 30..259 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.