DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG13318

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:105/248 - (42%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YPHQISMR-----YRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTG----- 101
            ||.|.::.     |.|    ||.:..:..:::|||.|..|    .||........|....     
  Fly   174 YPWQAALLTTADVYLG----GGALITAQHVLTAAHKVYNL----GLTYFKVRLGEWDAASTSEPI 230

  Fly   102 PQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDT--PVT------ 158
            |.|::.:..:.::|.:...|...|.|||.|.         .|:.|..:......  |.|      
  Fly   231 PAQDVYISNVYVNPSFNPNNLQNDVAILKLS---------TPVSLTSKSTVGTVCLPTTSFVGQR 286

  Fly   159 --VTGWGTTSEG--GTISDVLQEVSVNVVDNSNCKNAYS--------IMLTSRMLCAGVNGGGKD 211
              |.|||....|  |....:.::|.|.::.|:||:.|..        ::..:..:||| ...|||
  Fly   287 CWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAG-GEAGKD 350

  Fly   212 ACQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ||.||.|.|||..:.    ::|:|:||.|||:...||||.:|...|.|:..|:
  Fly   351 ACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 67/241 (28%)
Tryp_SPc 36..259 CDD:238113 68/245 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 68/245 (28%)
Tryp_SPc 169..399 CDD:214473 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.