DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG18180

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:236 Identity:73/236 - (30%)
Similarity:116/236 - (49%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRIVGGQDTNITQYPHQISM--RYRGNHR---CGGTIYRSNQIISAAHCVNTLSGPENLTIVAG 92
            :||||.|......:.|:.:.:  |..|::.   ..|||..::.|::||||   |:| :.:.|..|
  Fly    33 EGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHC---LTG-DYVEIHYG 93

  Fly    93 SSNIWFPTGPQQELEVRE-IIIHPKYRTLNNDYDAAILILDGDFEFNDAVQ--PIELAKERPD-- 152
            |:  |...|..::...|: .|.||.:.: ....|.. ||.....:||..:.  |:....|:.|  
  Fly    94 SN--WGWNGAYRQTVRRDNFISHPDWPS-QGGRDIG-LIRTPHVDFNGLINKIPLPSMNEQNDRY 154

  Fly   153 HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDS 217
            .||.....||| ..:.|.::|.||.|.|.::.||.|:.||..:.::.| |.. :..||..|.|||
  Fly   155 QDTWCVACGWG-GMDNGNLADWLQCVDVQIISNSECEQAYGSVASTDM-CTR-HADGKSVCGGDS 216

  Fly   218 GGPLVY--NNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||||.  |..|:|::::.:....:. |..|..|.|.|:|:
  Fly   217 GGPLVTHDNARLVGVITFASVSCHDG-PSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/231 (31%)
Tryp_SPc 36..259 CDD:238113 71/233 (30%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 71/232 (31%)
Tryp_SPc 36..259 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.