DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG3088

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:116/265 - (43%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVVFL---VLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRY-RGNHRCGG 63
            ::|||||   ::..|.:..|   ..:..||      |..|......|.|:.:.|.: :.|..|.|
  Fly     2 KLLVVFLGLTLVAAGSAKKD---SEDPDHI------ITNGSPAYEGQAPYVVGMAFGQSNIWCSG 57

  Fly    64 TIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAI 128
            ||.....|:::|.|   |:|...:||..|::.:       .:.:....:...:|.| .|.:.|.:
  Fly    58 TIIGDTWILTSAQC---LTGSSGVTIYFGATRL-------SQAQFTVTVGTSEYVT-GNQHLALV 111

  Fly   129 LILDGDF--EFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA 191
            .:....|  ..|....|....:.:...:....|.|||.|:....::|.||.|.:.::.|:.|...
  Fly   112 RVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAF 176

  Fly   192 Y-SIMLTSRMLCAGVNGGGKDACQGDSGGPLV--YNNTLLGIVSW--GTGCAREKYPGVYCSVPD 251
            | |..::.::||.. ...|:..|.||:|.||:  .::|::||.::  ..||.. ..|..:..:..
  Fly   177 YGSTTVSDQILCTR-TPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTL-GLPAGFARITS 239

  Fly   252 VLDWL 256
            .|||:
  Fly   240 ALDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 54/227 (24%)
Tryp_SPc 36..259 CDD:238113 56/229 (24%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 56/229 (24%)
Tryp_SPc 29..244 CDD:214473 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.