DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:236 Identity:86/236 - (36%)
Similarity:127/236 - (53%) Gaps:22/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNIT-QYPHQISMRYRGN-HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |||.|::|.:. ::|.|.|::..|: |:||.::..:..:::||||......|.......|::   
Human   205 RIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISNTWLLTAAHCFWKNKDPTQWIATFGAT--- 266

  Fly    98 FPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHD------TP 156
             .|.|..:..||:||:|..|....|:.|.|::.|....||::.||.:.|    ||..      |.
Human   267 -ITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCL----PDSSIKLPPKTS 326

  Fly   157 VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNC--KNAYSIMLTSRMLCAGVNGGGKDACQGDSGG 219
            |.|||:|:..:.|.|.:.|::..|..:....|  |:.|..::|..|||||...|..|||:|||||
Human   327 VFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDGLITPGMLCAGFMEGKIDACKGDSGG 391

  Fly   220 PLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||||:|    .::||||||..||..|.||||..|....||:
Human   392 PLVYDNHDIWYIVGIVSWGQSCALPKKPGVYTRVTKYRDWI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/233 (36%)
Tryp_SPc 36..259 CDD:238113 85/235 (36%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 85/234 (36%)
Tryp_SPc 206..435 CDD:238113 85/235 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.