DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG33465

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:286 Identity:72/286 - (25%)
Similarity:118/286 - (41%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGC-SLADPIYRNEEVHIPKLDGRI---VGGQDTNITQYPHQISMRYRGNHRC 61
            |||:|.:.|:..|.| .||..:  :::.|.||....|   .|..:|    .|...|:.......|
  Fly     1 MSRVLSLALIGLVLCQGLAQLL--DKKCHDPKTSENINFNHGATET----APWMASIYKNNQFIC 59

  Fly    62 GGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGP---QQELEVREIIIHPKYRTLNND 123
            .||:.....:::||.|:   |....|.::.|..|.:.....   .::..|...:.|..:|..|..
  Fly    60 DGTLVHKLFVLTAASCI---SKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGV 121

  Fly   124 YDAAILILDGDFEFNDAVQPIELAKERPDHDTPV-TVTGWGTTSEG-GTISDVLQEVSVNVVDNS 186
            .|..:|.|.|:......::||.:..:......|. ...|:|...:| ...|.|.|.|.::.....
  Fly   122 NDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPF 186

  Fly   187 NC-KNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL-------VYNNTL-LGIVSWGTG-CAREK 241
            .| :|...:.:.....|||  ...:..|:.:||.||       |.|.|: :|:||:|:. |:.  
  Fly   187 ECHRNGQLLPINEGQFCAG--NRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP-- 247

  Fly   242 YPGVYCSVPDVLDWLVETVADKESVG 267
             ..||..|....||:..||.:.|:.|
  Fly   248 -TSVYTDVVAFKDWIYNTVRNFETKG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 54/237 (23%)
Tryp_SPc 36..259 CDD:238113 56/240 (23%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 53/225 (24%)
Tryp_SPc 46..261 CDD:214473 52/222 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.