DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG32374

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:242 Identity:77/242 - (31%)
Similarity:109/242 - (45%) Gaps:23/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            |..|||.|:....::.|:|.::.|.....||..|.....|::|.||  .:..|...|:.|||:  
  Fly    70 LPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC--KIGNPGRYTVRAGST-- 130

  Fly    97 WFPTGPQQE-----LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH-DT 155
                  ||.     ..|::.:.||.|.......|..::.|.........||.::|...|... ..
  Fly   131 ------QQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPK 189

  Fly   156 PVTVTGWGTTSEGG-TISDVLQEVSVNVVDNSNCKNAY---SIMLTSRMLCAGVNGGGKDACQGD 216
            ....:|||.||... .:...|:.|.|..|..:.|:..|   .|.:..:|:||  ....:|.|.||
  Fly   190 CYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICA--KRKNRDTCSGD 252

  Fly   217 SGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADK 263
            ||||||:|..|.||.|:|.|||..||||||.:|.....| ::.||.|
  Fly   253 SGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRW-IKKVAKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 72/229 (31%)
Tryp_SPc 36..259 CDD:238113 72/232 (31%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 73/231 (32%)
Tryp_SPc 74..295 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.