DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and mas

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:250 Identity:77/250 - (30%)
Similarity:114/250 - (45%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISM-RYRGNHRCGGTIYRSNQIISAAHCVNTL----------SGPENLT 88
            |:|||:|....::..|::: .....:.||..:..:..:::|||||..:          .|..:||
  Fly   802 RVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLT 866

  Fly    89 IVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH 153
            ...||..       .|.|.|....||..:.:...|.|.|:|.|.|..|..|.|..:.|......|
  Fly   867 RKYGSPG-------AQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSH 924

  Fly   154 --DTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNC---KNAYS---IMLTSRMLCAGVNGGGK 210
              ....||||:|...|.|.|...::|..:.:|.::.|   .||.:   .:|.:...||| ...|.
  Fly   925 AAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAG-GEEGH 988

  Fly   211 DACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            ||||||.|||||..:    .|.|:||||.||.|:..||||......:.|:.:.::
  Fly   989 DACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQIIS 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 76/242 (31%)
Tryp_SPc 36..259 CDD:238113 76/245 (31%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.