DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG14990

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:277 Identity:70/277 - (25%)
Similarity:120/277 - (43%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVN 79
            |.:::|......|.:|| |....|       |:|..:::..:|.:...|::.....:::||..|.
  Fly    48 CGMSNPNGLVANVKVPK-DYSTPG-------QFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVV 104

  Fly    80 TLSGPENLTIVAGSSNIWFPTG------PQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFN 138
            ..:..| :.:.||..|    ||      |.::..|..::.|.::..|....:.|:|.|...||..
  Fly   105 GKTDAE-IVVRAGEWN----TGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELK 164

  Fly   139 DAVQPIELAKERPDHDTP-VTVTGWGTTS-EGGTISDVLQEVSVNVVDNSNCKN-------AYSI 194
            ..::.|.|..:....|.. ..|||||..: .....|::.:::.:.:::.:.|::       ..|.
  Fly   165 SHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSF 229

  Fly   195 MLTSRMLCAGVNGGGKDA--CQGDSGG---------PLVYNNTLLGIVSWGTGCAREKYPGVYCS 248
            .|.:.::||   ||.|||  |.||.|.         |..|...  |||:||.||..|..|.||.:
  Fly   230 DLPASLICA---GGEKDAGDCLGDGGSALFCPMEADPSRYEQA--GIVNWGIGCQEENVPAVYTN 289

  Fly   249 VPDVLDWLVETVADKES 265
            |....||:.|.:|...:
  Fly   290 VEMFRDWIYEHMAQNSN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 60/245 (24%)
Tryp_SPc 36..259 CDD:238113 62/248 (25%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 62/249 (25%)
Tryp_SPc 67..297 CDD:214473 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.