DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tpr

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:243 Identity:91/243 - (37%)
Similarity:125/243 - (51%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGS 93
            |..:..||||||:|.:.|||....:.|.|...|..::.....:::|:|||.... .|.:::....
  Fly   120 IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFR-KERISVRLLE 183

  Fly    94 SNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP-- 156
            .:.......:.:.:|.|:|.||||...|.|.|.||:.||...|||:.:.|:.:       .||  
  Fly   184 HDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM-------PTPGR 241

  Fly   157 ------VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNC-KNAYSIMLTSRMLCAGVNGGGKDACQ 214
                  ..|||||....||..||.||||.|.::....| |:.|...:|..|||.|.:.||||:||
  Fly   242 SFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQ 306

  Fly   215 GDSGGPL--VYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||||||  |.:.|    :.|:||||.|||:..|||||..|.....|:
  Fly   307 GDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 89/234 (38%)
Tryp_SPc 36..259 CDD:238113 89/236 (38%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/235 (38%)
Tryp_SPc 127..356 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.810

Return to query results.
Submit another query.