DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG11192

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:247 Identity:94/247 - (38%)
Similarity:138/247 - (55%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |||||||:...|.::|:|:|::.:|.|.|||.|...:.:::||||........:.|:..|||   
  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSS--- 86

  Fly    98 FPTGPQQE-----LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELA--KERPDHDT 155
                 :.|     |.:|.:|.|..|...::|.|.|:|||:|...|.:.:||:.||  .:.|..||
  Fly    87 -----EHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADT 146

  Fly   156 PVTVTGWGTTSEGGT------ISDVLQEVSVNVVDNSNCKNAYS--IMLTSRMLCAGVNGGGKDA 212
            .:.|:|||..:|...      :|..|:.|.|::|:::.|:.|||  :.:|.||:||.  ..|:|:
  Fly   147 RLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA--RPGRDS 209

  Fly   213 CQGDSGGPLVYNNT------LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ||||||||||....      |.||||||.|||...:||||.:|.....|:.|
  Fly   210 CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 90/240 (38%)
Tryp_SPc 36..259 CDD:238113 91/244 (37%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 90/241 (37%)
Tryp_SPc 28..262 CDD:238113 91/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
87.860

Return to query results.
Submit another query.