DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Tmprss4

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:230 Identity:91/230 - (39%)
Similarity:128/230 - (55%) Gaps:12/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            |:|||.:.:...:|.|:|::|...|.|||:|...:.|::||||........:..:.|||:.:   
  Rat   245 RVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAGSNKL--- 306

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL--AKERPDHDTPVTVTGW 162
             |....|.|.:|.|.........:.|.|::.|.....|:.:|:||.|  :.|......||.|.||
  Rat   307 -GNSPSLPVAKIFIAEPNPLQPKEKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVIGW 370

  Fly   163 GTTSE-GGTISDVLQEVSVNVVDNSNC--KNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYN 224
            |.|.| ||.:||.|.:.||.|:|::.|  ::||...:|:.|||||...||||.|||||||||:|:
  Rat   371 GFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTPQGGKDTCQGDSGGPLMYH 435

  Fly   225 N---TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            .   .::||||||.||.....||||..|...|||:
  Rat   436 YDKWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 89/227 (39%)
Tryp_SPc 36..259 CDD:238113 90/229 (39%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 90/228 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80930
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.