DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG6553

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster


Alignment Length:221 Identity:44/221 - (19%)
Similarity:61/221 - (27%) Gaps:97/221 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRC-GGTIYRS 68
            ||:||.|.|...|                    |.|  |.|..          .||| ||...:.
  Fly    12 LVIFLSLAVTICL--------------------GSQ--NATSC----------GHRCGGGDCIQL 44

  Fly    69 NQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAI---LI 130
            :|:...:  .|.|.|.:.  .||....:|.|.                 ......|.|.|   .:
  Fly    45 DQLCDGS--ANCLDGSDE--TVAMCEKVWCPG-----------------YAFRCSYGACIASTAV 88

  Fly   131 LDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKN----- 190
            .||   ..|.|.                    |:..:|......:|:        :||.|     
  Fly    89 CDG---VQDCVD--------------------GSDEQGWLCRAQMQQ--------ANCDNWEMYC 122

  Fly   191 AYSIMLTSRMLCAGVNGGGKDACQGD 216
            :....:|...||.|:    :|...||
  Fly   123 SSGQCMTYSKLCDGI----RDCRDGD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 37/191 (19%)
Tryp_SPc 36..259 CDD:238113 37/190 (19%)
CG6553NP_610911.1 LDLa 34..60 CDD:197566 9/27 (33%)
LDLa 70..101 CDD:197566 9/70 (13%)
LDLa 115..146 CDD:197566 9/34 (26%)
Frag1 <260..>303 CDD:287278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.