DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG13744

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:271 Identity:83/271 - (30%)
Similarity:130/271 - (47%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EVHIPK-----LDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPE 85
            |..:|:     |..||:||:.....:||.|..:|. ..::|||.:..:|.:.:||||:.. :...
  Fly   127 ECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQ-AHLA 189

  Fly    86 NLTIVAGS------SNIWFPTGPQQELEVREIIIHPKYR---TLNNDYDAAILILDGDFEFNDAV 141
            ::|:..|.      .:|..|. |.::..|.:.||||::.   |..:.||.|:|.|.....|.:.:
  Fly   190 DITVYLGELDTQDLGHIHEPL-PVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHI 253

  Fly   142 QPIELAKERPDHDTPV-------TVTGWGTTSE--GGTISDVLQEVSVNVVDNSNC-----KNAY 192
            .||.|    |.:  |:       .:.|||.|..  |...:::||..||.::...:|     ....
  Fly   254 LPICL----PQY--PIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQI 312

  Fly   193 SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVL 253
            ::.:.:.|.|||.:.|..|||.||||||||...    .|:||.|.|.||..:..||:|.:|...:
  Fly   313 NVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTV 377

  Fly   254 DWLVETVADKE 264
            .|:.|.||..|
  Fly   378 RWIQEVVARNE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/246 (30%)
Tryp_SPc 36..259 CDD:238113 75/249 (30%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 75/247 (30%)
Tryp_SPc 142..383 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.