DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Np

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:244 Identity:84/244 - (34%)
Similarity:126/244 - (51%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMR-YRGN---HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSN 95
            |||||.:....::|.|||:| :|.:   |:||..:...|..|:|||||:.:. |.:|.:..|..:
  Fly   797 RIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVP-PSDLLLRLGEYD 860

  Fly    96 IWFPTGP--QQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHD---- 154
            :.....|  .||..|:.:..||::.....:||.|:|.......|...:.|:.:    ||:|    
  Fly   861 LAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCV----PDNDENFI 921

  Fly   155 -TPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIM-----LTSRMLCAGVNGGGKDAC 213
             ....|||||...|.|.:..|||||:|.|::|:.|::.|...     :....:|||...||.|:|
  Fly   922 GQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSC 986

  Fly   214 QGDSGGPLVYNNT------LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            :||||||:|....      |.|::|||.|||....||||..:.:..||:
  Fly   987 EGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/241 (34%)
Tryp_SPc 36..259 CDD:238113 83/243 (34%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 83/242 (34%)
Tryp_SPc 798..1038 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.810

Return to query results.
Submit another query.