DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and flz

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:268 Identity:91/268 - (33%)
Similarity:125/268 - (46%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NEEVHIPKLD---------GRIVGGQDTNITQYPHQISMR---YRG---NHRCGGTIYRSNQIIS 73
            |...|.|..:         ||||||:.:....||.|:.:|   :.|   .::|||.:..|..:|:
  Fly  1428 NLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVIT 1492

  Fly    74 AAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELE--------VREIIIHPKYRTLNNDYDAAILI 130
            ||||......  :|..|.|..:|      ..:||        |:.:|:|.:|.....:.|.|:|.
  Fly  1493 AAHCQPGFLA--SLVAVMGEFDI------SGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLE 1549

  Fly   131 LDGDFEFNDAVQPIELAKERPDH-DTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSI 194
            ||...:|:..:.||.:..:..|. ....||||||....||.:..|||||.|.:::||.|:..:..
  Fly  1550 LDSPVQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHT 1614

  Fly   195 ------MLTSRMLCAGVNGGGKDACQGDSGGPLVYNN-----TLLGIVSWGTGCAREKYPGVYCS 248
                  :||| .||||...|.||:|:||||||||...     .|.|.||.|..||....||||..
  Fly  1615 AGHNKKILTS-FLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMR 1678

  Fly   249 VPDVLDWL 256
            ......||
  Fly  1679 TTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/245 (35%)
Tryp_SPc 36..259 CDD:238113 86/247 (35%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 86/247 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.