DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG30371

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:252 Identity:75/252 - (29%)
Similarity:133/252 - (52%) Gaps:24/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHR---CGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            ||..||.....::|...:::....::   |||||.....|::||||:..:|...|:..:.|::::
  Fly   149 RIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDL 213

  Fly    97 WFPTGPQ--QELEVREIIIHPKYRT---LNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
            ..|:..:  |:..::::|.|.:|.:   :||  |.|:||...:.:::..|.||.|..  ....||
  Fly   214 GNPSSSRYYQQYNIQQMIPHEQYVSDPDVNN--DIAVLITASNIQWSRGVGPICLPP--VGTSTP 274

  Fly   157 VT-----VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY---SIMLTSRMLCAGVNGGGKDAC 213
            .|     |.|:||....|..|..||::::|||.|.:|:..|   :.:.|.:|.....:|.|:|:|
  Fly   275 FTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMCTYDYSGTGRDSC 339

  Fly   214 QGDSGGPLVYNNT---LLGIVSWGTGCAREKYP-GVYCSVPDVLDWLVETVADKESV 266
            |.|||||::...:   |:||:|:|..||..:|| ||...:...:.|:.:.:.:...|
  Fly   340 QFDSGGPVILRKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIRQKIGNSNCV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 73/239 (31%)
Tryp_SPc 36..259 CDD:238113 73/242 (30%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 73/240 (30%)
Tryp_SPc 150..389 CDD:238113 73/242 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.