DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and scaf

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:247 Identity:66/247 - (26%)
Similarity:99/247 - (40%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DTNITQYPHQISMRYRGNHR---CGGTIYRSNQIISAAHCVNTL--------SGPENLTIVAGSS 94
            |.|..:.|.| :|..|.:.:   |||.|.....::|:|.|||.|        :|...|    ||:
  Fly   428 DANFAEIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWEL----GST 487

  Fly    95 NIWFP---TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
            |...|   ||      |:.:.:||.|....|.:|.||:.|:...||...:|||.::.|.|.....
  Fly   488 NEPLPFQLTG------VKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQ 546

  Fly   157 VTVTGWGTTS-----EGGT--ISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQ 214
            ...:|||..:     ||..  ::|.|.:.      .|.|.      ..|..:|:...   .|:||
  Fly   547 CFTSGWGKQALSIHEEGALMHVTDTLPQA------RSECS------ADSSSVCSATK---FDSCQ 596

  Fly   215 GDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVAD 262
            .|.|..|...:    .|.||.:....|...:  .|..:.||: .|:....|:
  Fly   597 FDVGSALACGSGSSVRLKGIFAGENSCGEGQ--TVRFAKPDI-KWINTAFAE 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 64/238 (27%)
Tryp_SPc 36..259 CDD:238113 65/242 (27%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/213 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.