DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG4650

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:91/252 - (36%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGR---IVGGQDTNITQYP-----HQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLT 88
            ||||   :..|:..|....|     |...:.|    .||||:.....:::||||..   ..|.|.
  Fly    24 LDGRCGLLTNGKIANNISSPWMAYLHTSELLY----VCGGTVITEKLVLTAAHCTR---ASEQLV 81

  Fly    89 IVAGSSNIWFPTGPQ-----QELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI---- 144
            ...|.   :..|...     .|.:|.:..||..|.|..:..|.|||.|..|..|:..::||    
  Fly    82 ARIGE---FIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVW 143

  Fly   145 -ELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGG 208
             .:.::..|:...::...||..::... ||..:...:.....:.|.......:.|...|||  ..
  Fly   144 WTIWRKYIDNIQVLSGAQWGLPNDRNE-SDAFRITDIRRQPANMCSTLNGTAILSSQFCAG--DS 205

  Fly   209 GKDACQGDSGGPL--------VYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ....|..|...||        :....|:||.:....|.|   ..||..|....|:::
  Fly   206 DSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKR---ASVYTDVLSHTDFIL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 55/245 (22%)
Tryp_SPc 36..259 CDD:238113 55/245 (22%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 55/240 (23%)
Tryp_SPc 33..258 CDD:304450 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.