DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and TMPRSS7

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:242 Identity:89/242 - (36%)
Similarity:124/242 - (51%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV--NTLSGPENLT-----IVAG 92
            ||:||.||....:|.|:|:.:.|:..||.::.....::|||||.  |.||.|...|     .|.|
Human   605 RIIGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQG 669

  Fly    93 SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDF--EFNDAVQPIEL--AKERPDH 153
            ::....|        ||.|::|..|.:...|||.|:|.|...:  .....:|||.:  ..:|...
Human   670 NAKFVSP--------VRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQRVRS 726

  Fly   154 DTPVTVTGWGTTSEG---GTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQG 215
            .....|||||...|.   |::  |||:..|.::|.:.|.:.|.| :||||||||:..|.:|||:|
Human   727 GEKCWVTGWGRRHEADNKGSL--VLQQAEVELIDQTLCVSTYGI-ITSRMLCAGIMSGKRDACKG 788

  Fly   216 DSGGPLVYNN------TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||||||....      .|.||||||.|..|..:||||..|.:.:.|:
Human   789 DSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 88/239 (37%)
Tryp_SPc 36..259 CDD:238113 88/241 (37%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.