DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Try29F

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:103/267 - (38%)
Similarity:145/267 - (54%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFL--VLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIY 66
            ||.:|:  :|.|..||...:.|      |:|||||||||..||...|:|:|:: |..|.|||::.
  Fly    14 ILHLFIGGILLVNLSLGATVRR------PRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLI 71

  Fly    67 RSNQIISAAHC-------VNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDY 124
            ....:::||||       ::.:....:.|.|.|           |.:.::.:..|||:.....|:
  Fly    72 AQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGG-----------QLVGIKRVHRHPKFDAYTIDF 125

  Fly   125 DAAILILDGDFEFNDAVQP-IELAKERPD--HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNS 186
            |.::|.|: ::...:..|. :.|.::..|  ..|||.|:|||.|......|.||:.|:|..|..:
  Fly   126 DFSLLELE-EYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQT 189

  Fly   187 NCKNAYSIM--LTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSV 249
            .|..||...  :|.||||||:..||||||||||||||..:..|.|:||||.||||..|||||..|
  Fly   190 QCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRV 254

  Fly   250 PDVLDWL 256
            ..|.||:
  Fly   255 SAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 89/231 (39%)
Tryp_SPc 36..259 CDD:238113 90/233 (39%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 90/232 (39%)
Tryp_SPc 42..264 CDD:238113 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443292
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.