DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and OVCH1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:241 Identity:88/241 - (36%)
Similarity:131/241 - (54%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            |..||.||::.....:|.|:.:|:.|:::|||.|.....|::|||||...:.|.:.||:||..:.
Human   606 LSRRIAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLSWTIIAGDHDR 670

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV---- 157
            ......:|....:.||:|..:.||:.|.|.|::.|....|:|..|:|:.|    |....|:    
Human   671 NLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCL----PHSAEPLFSSE 731

  Fly   158 --TVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIM----LTSRMLCAGVNGGG-KDACQG 215
              .|||||:.|..|.::..||::.|:|::...|::.|...    :|.:|:|||....| ||.|||
Human   732 ICAVTGWGSISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQG 796

  Fly   216 DSGGPLVYNN-----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||||||..:     .|.||||||.||.:...|||:..|...|||:
Human   797 DSGGPLVCRHENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWI 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/235 (36%)
Tryp_SPc 36..259 CDD:238113 86/237 (36%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001
CUB 454..565 CDD:238001
Tryp_SPc 610..845 CDD:238113 86/237 (36%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.