DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS53

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:292 Identity:65/292 - (22%)
Similarity:106/292 - (36%) Gaps:84/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPE--NLTIVAGSSN 95
            :|..|.|      ::|.|.|:|.:|.|.|.|::.....:::||||....:..|  :.::|.||..
Human    40 EGNTVPG------EWPWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQ 98

  Fly    96 IWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQP---IELAKERPDHDTPV 157
            ....:...:|:.|..:.:...|...:...|.|:|.|         ..|   ..|...:|.|..|.
Human    99 REGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQL---------AHPTTHTPLCLPQPAHRFPF 154

  Fly   158 TVTGWGT-----TSEGG----------------TIS----------------------------D 173
            ..:.|.|     ||:|.                |:|                            .
Human   155 GASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPG 219

  Fly   174 VLQEVSVNVVDNSNCKNAYSIMLTSR---------MLCAGVNGGGKDACQGDSGGPLVY-----N 224
            .|:.:.:.::....|...|: .|..|         |||.|...|.:..||||||||::.     :
Human   220 TLRNLRLRLISRPTCNCIYN-QLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGH 283

  Fly   225 NTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ....||:|:.:.||:|..|.:..:......||
Human   284 WVQAGIISFASSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 62/287 (22%)
Tryp_SPc 36..259 CDD:238113 64/289 (22%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 64/290 (22%)
Tryp_SPc 43..314 CDD:214473 62/286 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.