DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG31954

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:99/274 - (36%)
Similarity:146/274 - (53%) Gaps:23/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVV----FLVLGVGCSLADPIYRNEEVH---------IPKLDGRIVGGQDTNITQYPHQISMR 54
            |:.|:    .|||...|.:..|:.|...:.         .|:||||||||...|||..|||:|::
  Fly     5 RLFVLLQCSLLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQ 69

  Fly    55 YRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRT 119
             ..:|.|||:|.....|::||||....:. :.|.:..|:|..   ....|.|.|::|:.|.::..
  Fly    70 -TSSHICGGSIISEEWILTAAHCTYGKTA-DRLKVRLGTSEF---ARSGQLLRVQKIVQHAQFNY 129

  Fly   120 LNNDYDAAILILDGDFEFNDAVQPIELAKERPDH--DTPVTVTGWGTTSEGGTISDVLQEVSVNV 182
            .|.|||.::|.|....:|::..:.::|.:.:..:  .....|:|||.|.......:.|::|.|.:
  Fly   130 TNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPL 194

  Fly   183 VDNSNCKNAYSIM--LTSRMLCAGVNGGGKDACQGDSGGPLV-YNNTLLGIVSWGTGCAREKYPG 244
            |:...|...|...  :|.||:|||...|||||||||||||:| .:..|:|:||||.|||:..|||
  Fly   195 VNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPG 259

  Fly   245 VYCSVPDVLDWLVE 258
            ||..|....||:.|
  Fly   260 VYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/224 (38%)
Tryp_SPc 36..259 CDD:238113 86/228 (38%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 85/225 (38%)
Tryp_SPc 51..274 CDD:238113 86/228 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.