DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and prss60.3

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:264 Identity:94/264 - (35%)
Similarity:133/264 - (50%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISM---RYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGS 93
            |:.|||||.:.:...:|.|:|:   :| |.|.|||::..|..:::||||   |||....|:|   
Zfish    32 LNTRIVGGVNASPGSWPWQVSLHSPKY-GGHFCGGSLISSEWVLTAAHC---LSGVSETTLV--- 89

  Fly    94 SNIWFPTGPQQELEVREI-------IIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERP 151
              ::.....||.:.:.|.       .:|..|.:..||.|.|:|.|.....|.:.::|:.||.:..
Zfish    90 --VYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNS 152

  Fly   152 DHD--TPVTVTGWGTTSEGGTI--SDVLQEVSVNVVDNSNCKNAY--SIMLTSRMLCAGVNGGGK 210
            .:.  |...:||||....|..:  ..:|||..:.||.|..| ||.  |..:|:.|:|||:..|||
Zfish   153 VYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-NALLGSGTVTNNMICAGLTQGGK 216

  Fly   211 DACQGDSGGPLVYNNTLL-------GIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVGK 268
            |.||||||||:|   |.|       ||.|||.|||....||||..|.....|    ::.|.|:.|
Zfish   217 DTCQGDSGGPMV---TRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSW----ISSKISLNK 274

  Fly   269 IDFL 272
            ..|:
Zfish   275 PGFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 88/242 (36%)
Tryp_SPc 36..259 CDD:238113 88/245 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 88/249 (35%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.