DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG4271

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:229 Identity:64/229 - (27%)
Similarity:101/229 - (44%) Gaps:11/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPT 100
            |..|.:.....:....|:...|.|.|||.:..|..:::||.||.. ...:.:|:..|:.:|:   
  Fly    19 IYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKN-KPVKRITVRVGTPDIY--- 79

  Fly   101 GPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWG-T 164
            ...:.:.|..:::|..|:  |.|.|.|:|.|:... .:..|..|.||.:.|..:...:..||| .
  Fly    80 RGGRIIRVTALVVHENYK--NWDNDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSNAGWGEK 141

  Fly   165 TSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLG 229
            ..|...::..||.....:...|.|.......:...:|||...  ..|.|.||.|||||..|.::|
  Fly   142 LLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEELLCAFYT--ENDICPGDYGGPLVLANKVVG 204

  Fly   230 IVSWGTGCAREKYPGVYCSVPDVLDWLVETVADK 263
            |...|.||.....|.:|.:|...|:|:.|. |:|
  Fly   205 IAVQGHGCGFAVLPSLYTNVFHYLEWIEEN-AEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 60/219 (27%)
Tryp_SPc 36..259 CDD:238113 61/223 (27%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 61/223 (27%)
Tryp_SPc 19..231 CDD:214473 60/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.