DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Ser12

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:241 Identity:86/241 - (35%)
Similarity:122/241 - (50%) Gaps:36/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV----NTLSGPENLTIVAGSSN 95
            |||||....|::.|.|.::.|...:.||..||....||:|||||    :||     .::..||  
  Fly    23 RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTL-----YSVRVGS-- 80

  Fly    96 IWFPTGPQQELEVREIIIHPKYRTLNNDY--------DAAILILDGDFEFNDAVQPIELAKERPD 152
            :|...|.|   ..|..:|..     :.||        |.|::.|.....||..|:||:||...|.
  Fly    81 VWKNLGGQ---HARVAVIRK-----HEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPA 137

  Fly   153 HDTPVTVTGWGTTSEGGTI---SDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQ 214
            ..|..:|:|||   |.|.:   ...|.:.||.::|.:.||.:|. .:|..|:||...  .||:|.
  Fly   138 AGTEASVSGWG---EIGILWLQPTSLLKTSVKILDPNVCKRSYQ-YITKTMICAAAL--LKDSCH 196

  Fly   215 GDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ||||||||....|:||||:|.|||...:||||.:|.::..|::..:
  Fly   197 GDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/234 (36%)
Tryp_SPc 36..259 CDD:238113 85/237 (36%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 85/235 (36%)
Tryp_SPc 24..238 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.