DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG11912

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:283 Identity:81/283 - (28%)
Similarity:127/283 - (44%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVF-LVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGN-HRCGG 63
            |.:..|:| |.|....:::.|     :...|  :|||:.|.:....:.|:.:|::...| |.|.|
  Fly     1 MKQFAVIFALALASVSAISVP-----QPGFP--EGRIINGYEAAKGEAPYIVSLQTTSNSHFCAG 58

  Fly    64 TIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVR-----EIIIHPKYRTLNND 123
            ::.....|::||||:....|    ..|||:.:    ...|:.:::|     :.:||..|......
  Fly    59 SLLDEVTIVTAAHCLTYNQG----QAVAGAHS----RTDQENVQIRKFTNAQYVIHENYGGGVGP 115

  Fly   124 YDAAILIL--DGDFEFN----DAVQPIELAKERPDHDTPVT----VTGWGTTSEGGTISDVLQEV 178
            .|..:::|  :..|:.|    |...|:. |...|......|    :.||| ....|.:...||::
  Fly   116 NDIGLILLKEEDAFDLNAVARDGSNPVS-AVSLPSKTFQGTSDGYLYGWG-RDNSGLLPLNLQKL 178

  Fly   179 SVNVVDNSNCKNAY--SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNT-----LLGIVSWG-T 235
            ...:||.:.||.|.  :..|....:|....|....:|.||||||||..::     |:|||||| |
  Fly   179 DAIIVDYNECKAALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYT 243

  Fly   236 GCAREKYPGVYCSVPDVLDWLVE 258
            .|....||.||.||...|.|:.|
  Fly   244 PCLSTTYPSVYTSVSSFLPWIDE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/243 (29%)
Tryp_SPc 36..259 CDD:238113 72/247 (29%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 71/244 (29%)
Tryp_SPc 30..267 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.