DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss53

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:241 Identity:65/241 - (26%)
Similarity:102/241 - (42%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            |..|.|...::|:|....:::.|...|||.:.....:::||||.......|..::..|:      
Mouse   300 RSAGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGA------ 358

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKE-RP------DHDTPV 157
             || :|..::::|:|..|......||.|.|:|         .||:.|... ||      ||..|.
Mouse   359 -GP-EEWGLKQLILHGAYTHPEGGYDVAFLLL---------AQPVTLGPGLRPLCLPYADHHLPD 412

  Fly   158 TVTGW--GTTSEGGTISDVLQEVSVNVVDNSNCKNAYS------IMLTSRMLCAGVNGGGKDACQ 214
            ...||  |.|.:.|.  :..|.|.|.|:....|...::      |.:...|:|..| .|....|:
Mouse   413 GEHGWVLGLTQKAGI--NYPQTVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTV-VGEPPHCE 474

  Fly   215 GDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |.||.|||:...    |:|:.|:|..|.....|.|:.::....||:
Mouse   475 GLSGAPLVHEIRGTWFLVGLHSFGDTCQSSAKPAVFAALSAYEDWI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 63/238 (26%)
Tryp_SPc 36..259 CDD:238113 64/240 (27%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 62/230 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.