DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP006489

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_557171.2 Gene:AgaP_AGAP006489 / 3290176 VectorBaseID:AGAP006489 Length:278 Species:Anopheles gambiae


Alignment Length:210 Identity:47/210 - (22%)
Similarity:82/210 - (39%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQ--------DTNITQYPHQISMRY-RGNHRCGGTIYRSNQIISAAHCVNTLSG----PENL 87
            ::|.|        ||...::|..:.::. |.|..|.||:..||.::::|.||.:...    |..|
Mosquito    13 LIGSQAQTPTLLRDTIWGEFPSVVRVKTPRENQFCLGTVINSNHVLTSAFCVLSYDRMRIFPARL 77

  Fly    88 T-IVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEF-NDAVQPIELAKER 150
            . ::.|..::......:|....:.|.:|..||....:.:.||:.|...|.. ::|::...:....
Mosquito    78 VRVIGGDISVTPAAITRQTRTGQHIFVHEDYRPHTYENNLAIIRLAEPFHLPSNAIEEAVIRMRI 142

  Fly   151 PDHDTPVTVTGW----GTTSEGGTISDV--LQEVSVNVVDNSNC--KNAYSIMLTSRMLCA---- 203
            .....|..|..|    ||  ||....::  .|..:||:.:...|  :......|....||.    
Mosquito   143 VPEQHPCDVVTWYRAPGT--EGNPSQEIPRQQAFNVNIRNRDVCAAERRTEFTLEENSLCTYTTT 205

  Fly   204 --GVNGGGKDACQGD 216
              ||..|....|.|:
Mosquito   206 TIGVVQGDPMFCDGE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 47/210 (22%)
Tryp_SPc 36..259 CDD:238113 47/210 (22%)
AgaP_AGAP006489XP_557171.2 Tryp_SPc 30..225 CDD:304450 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.