DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss34

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:252 Identity:78/252 - (30%)
Similarity:123/252 - (48%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRY------RGNHRCGGTIYRSNQIISAAHCVNTLSGPE-----NLTI 89
            ||||...:.:::|.|:|:|.      |..|.|||::.....:::|||||.    |:     .:.:
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVR----PKEVEAYGVRV 95

  Fly    90 VAGSSNIWFPTGPQQELEVREIIIHPKYR---TLNNDYDAAILILDGDFEFNDAVQPIEL--AKE 149
            ..|...::   ...|.::|.:||.|||:.   :.....|.|:|.||.....::.|.|:.|  |..
Mouse    96 QVGQLRLY---ENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASL 157

  Fly   150 RPDHDTPVTVTGWGTTSEGGTISDV--LQEVSVNVVDNSNCKNAYSI---------MLTSRMLCA 203
            |........|.|||.......:...  |:||:|.:|:|::|:..|..         ::...||||
Mouse   158 RISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCA 222

  Fly   204 GVNGGGKDACQGDSGGPLV--YNNT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |..  |:|:|:.|||||||  :|.:  .:|:||||.||....:||||..|...:.|:
Mouse   223 GKE--GRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/249 (31%)
Tryp_SPc 36..259 CDD:238113 78/252 (31%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 78/252 (31%)
Tryp_SPc 35..277 CDD:214473 77/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.